Protein Info for Psyr_5128 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP synthase I chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details PF03899: ATP-synt_I" amino acids 19 to 115 (97 residues), 76.3 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 81% identical to ATPZ_PSEPU: ATP synthase protein I (atpI) from Pseudomonas putida

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to psp:PSPPH_5214)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL17 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Psyr_5128 ATP synthase I chain (Pseudomonas syringae pv. syringae B728a)
MESRMPDRLPFYRLAVFPLLLAQLIVLLMAALVLWQWQGVVAGYSGLCGGLIAWLPNLYF
AHKAFRFSGARAAQAIVRSFYAGEAGKLIFTAVLFALTFAGVKPLAPLAVFGVFMLIQVV
NWFAPLLTRTRLSRP