Protein Info for Psyr_5109 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 70 to 98 (29 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 194 (29 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF02366: PMT" amino acids 64 to 235 (172 residues), 25.3 bits, see alignment E=1e-09 PF13231: PMT_2" amino acids 66 to 222 (157 residues), 55.9 bits, see alignment E=6.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_5109)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL36 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Psyr_5109 Glycosyl transferase, family 39 (Pseudomonas syringae pv. syringae B728a)
MTVRTHLSPRLEGWLLVALAVLLVGGGLGLRLPQNVDEERFLGVALEMLQNGSWFVPHRA
AQIYADKPPLFMWATAFFIWLTGSPNIALYLPGLLSAGATTAVLYDLGTRLWNRRIGRYA
ALLFLATYQTYSILRTGQIDSFLCLWIALGFYGLVRHVLLGPAWGWFYFSCAAMGLGIIT
KGVGFVPALMLIPYAYAARKGWQGVVAMPGQAARWALGLLVLLLACCLWLVPMIISVVRD
GGPEGFAYVQEILLHQTANRYASAWDHREPFWYFFVKVIPQYWLPLVLVLPWLIPAWRRQ
LGKHDGRVLVLLGWVLLVLLFFSLSSGKRKIYIFPALPGLVLVAAPLLPWLLKRWFHDRI
RARRIVPVVVVVWLGLWFARGFVEPFIEGQNPHKELMEQAAYVTQGADLVLINWREGHWL
YARQPIVHFGFAKPSATEQAARWLREHPGTFALVPGEQLANCFLPEKARPLGQTSRADWF
IVDADADNGRCKPQRPMQAYRFAWQQNVD