Protein Info for Psyr_5106 in Pseudomonas syringae pv. syringae B728a

Annotation: NAD-dependent epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 185 (185 residues), 63 bits, see alignment E=7.7e-21 PF02719: Polysacc_synt_2" amino acids 3 to 229 (227 residues), 40.1 bits, see alignment E=7.8e-14 PF01370: Epimerase" amino acids 3 to 231 (229 residues), 198.4 bits, see alignment E=3.9e-62 PF16363: GDP_Man_Dehyd" amino acids 4 to 312 (309 residues), 166 bits, see alignment E=4.7e-52 PF01073: 3Beta_HSD" amino acids 4 to 278 (275 residues), 60.3 bits, see alignment E=4.7e-20

Best Hits

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 100% identity to psb:Psyr_5106)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL39 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psyr_5106 NAD-dependent epimerase/dehydratase (Pseudomonas syringae pv. syringae B728a)
MTVLVTGAAGFIGFHVAKRLCELGVEVVGIDNLNDYYSVELKQSRLALLQRLPGFTFHRL
DITDAEGLSALFAQNGFEQVIHLAAQAGVRYSLEQPNVYAQSNLVGFINVLEACRQYRPA
HLIYASSSSVYGANTRMPFQVEDAVDRPLSLYAATKRANELTAYSYCHLYGLRATGLRFF
TVYGPWGRPDMALFKFTKAMLAGQPVDIYNHGEMARDFTYIDDIVESILRLRLLPPDAVG
SEPPHQLFNIGRGQPVKLLEFVDCLEAALGLRAERRYLPLQAGDVLQTWADVSALSQWID
FQPQVSVDTGVRAFVDWYREHYQARICEPLQ