Protein Info for Psyr_5105 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 9 to 424 (416 residues), 444 bits, see alignment E=2.3e-137 PF03721: UDPG_MGDP_dh_N" amino acids 9 to 191 (183 residues), 186.3 bits, see alignment E=8.8e-59 PF00984: UDPG_MGDP_dh" amino acids 208 to 300 (93 residues), 127.7 bits, see alignment E=3.2e-41 PF03720: UDPG_MGDP_dh_C" amino acids 324 to 428 (105 residues), 101.2 bits, see alignment E=7.7e-33

Best Hits

Swiss-Prot: 45% identical to UDG_RHIME: UDP-glucose 6-dehydrogenase (rkpK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to psb:Psyr_5105)

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL40 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psyr_5105 UDP-glucose 6-dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MRRKERHLKVTVFGTGYVGLTLAACLAEVGHTVCCMDVDSKRIDALREGICPIFEPGLGE
LLRNGLDCKRLSFTTDEVHASRFAELVFIAVGTPAQADGKADLSQVLAVLRCVIRHAESA
PIIVNKSTSPVGTVDRLLAEIAASARCDDGFEVISNPEFFKEGCAVSDCLRPDRIIVGGA
SPRALEQMRELYQPFSRNREKFVVMDARSAELSKYAANCLLATKISFINEIANLAEQVGA
DIEQVRLGIGSDPRIGYDFIYPGCGFGGSCFPKDLQALIGTASEHGVETALLNAVEQVNR
RQKHRLFENIHTHYHGDLRGKVFAVWGLAFKPNTDDIREATSHTLLKALWAAGARVQAHD
PQAIEAVRHHYGERNDLQLVQCKQDALEGADALVVVTEWQDYRVLDLDALGETLGDRVVF
DGRNLFDPLQLREAGFTYYGIGRGQATPA