Protein Info for Psyr_5091 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 196 to 205 (10 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 380 to 405 (26 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 448 to 472 (25 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details amino acids 551 to 570 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 260 (169 residues), 39.3 bits, see alignment E=2.9e-14 amino acids 398 to 568 (171 residues), 59.9 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to psb:Psyr_5091)

Predicted SEED Role

"ABC-type anion transport system, duplicated permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL54 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Psyr_5091 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MHSIFEFGKSLRTPRFVKPGARTPYWADGICLAILTLFIGLFIYGLGQMMQPLAVLNSSP
MSLDPARLPEYALRTTMRMFIALAASLIFTFVVATLAAKSRKAEQVIIPALDILQSVPVL
GFLTFTVTFFMGLFPGRQMGVECAAIFAIFTSQAWNLAFSFYQSLRTVPSDLNEVSRQFG
LSAVLRFTRLELPFAIPGLVWNMMMSMSGGWFFVVACEAISVGDTTVNLPGIGSWLALTI
EQKNLAAIAWAVGAMALVILAYDQLLFRPIVAWADKFRFEQTASSKRPRSWMYSVLGRSR
VAPMLGSVLAAPWKCLMLIDGRVISRLWKVKLTPGVARVLDYAWLGLVMAACLAGSVYLF
RFIEASLGASDMVTAFGLGLATMVRVIVLIVVASLIWVPVGIWIGLRPVWAERLQPIAQF
MAAFPANVLFPFAVIAIVGLHLNPDIWLSPLMVLGTQWYILFNVIAGASALPTDLREAAT
MFNMRGWQWWRRVALPGVFPYYITGALTASGGSWNASIVAEAVSWGDQHLEAAGLGSYIA
NATQAGDFPRVALGIVVMSVFVIAFNRLLWRPLYGFAERRLSLV