Protein Info for Psyr_5084 in Pseudomonas syringae pv. syringae B728a

Annotation: Band 7 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF01145: Band_7" amino acids 328 to 545 (218 residues), 82.8 bits, see alignment E=1.5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_5084)

Predicted SEED Role

"Membrane protease subunits, stomatin/prohibitin homologs"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL61 at UniProt or InterPro

Protein Sequence (648 amino acids)

>Psyr_5084 Band 7 protein (Pseudomonas syringae pv. syringae B728a)
MRVDLDEHEGLDGLPRFQMAVQQVRRLGRLMYVTGGAGAFGLLLALSIDLFSPGSLWMAV
LCNASAALFLLTAGLQSARHVALWRARALRLPDADTLDENLSAGDESGWYERLLERLSDS
GKSLVRHVGSSTLWLAAWAVLALIVVRAFWNLALFGVDLSTAGSLAGSVMLLLAFGLLVI
ERQLSSESDSQSPEAGALAQLVRMTLIVLLIGALCLFFSSAERVWPARLAVLIGLLPLGV
ALEFLLRAVLSVFSPRNPRSEPRLLAASFIADLLRWPPRPLLALQHELHNRFGIDLRQIW
AFTYMRRAFLPVLAVVAALGWVLSGVHEIPMQGRGIYERFGKPVDVFGPGLHVGLPWPFG
RVLAVENGVVHELATSVSAADTFEQTLDPAEGPPPGSANRLWDASHINEKSQVIASSAGD
KQSFQIVNMDVRFVYRIGLTDAAAMASTYNSADIPALIRSTASRVLVHDFASRTLDELLG
EQRSGLADDIGKAVQADLQRLDSGVELLATVVEAIHPPAGAANAYHAVQAAQIGAQALIS
RERGAASDKANQAQLNASVARDQASAAAREILAGAQGADLRFSAERQAYAKAGQAFLLEQ
YLAQLTEGLGNAKLLILDHRLGGDSAPTIDLRTFTPPADPTAPRKAVQ