Protein Info for Psyr_5068 in Pseudomonas syringae pv. syringae B728a

Annotation: transporter, CPA2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 466 to 484 (19 residues), see Phobius details amino acids 515 to 538 (24 residues), see Phobius details amino acids 544 to 564 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 376 (363 residues), 209.2 bits, see alignment E=4.7e-66

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to psb:Psyr_5068)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL77 at UniProt or InterPro

Protein Sequence (587 amino acids)

>Psyr_5068 transporter, CPA2 family (Pseudomonas syringae pv. syringae B728a)
MHAINFIQDLAVIMLVAGVVTILFHRLRQPVVLGYIVAGFIIGPHTPPFSLIHDEETIKI
LAELGVIFLMFCLGLEFSLRKLFKVGATAFIAAFLEIALMIWIGYEIGQFFGWKTMDSLF
LGAILAISSTTIIVKALNDLKMKNQRFAQLIFGVLIVEDILGIGIIALLSGIAVSGSVSS
GEVFSTVGKLSLFMIVALVIGILVVPRLLSYVARFESNEMLLITVLGLCFGFCLLVVKLE
YSMVLGAFLIGAIMAESRELLKIERLIEPVRDMFSAIFFVAIGLLIDPGILLQYAWPIAV
ITVAVVLGKMLSCGLGAFIAGNDGRTSLRVGMGLSQIGEFSFIIAALGMTLQVTSDFLYP
VAVAVSAITTLLTPYLIRGADPLSLKLAAIMPRRVARVFGMYGEWLRSIQPQGQSAVLAG
MIRRILLQVGVNLALVMAIFFSGGYFAERLGGYMSEWVGDVSQQKAWICGAALLLSLPFL
IAAYRKLKALSMLLAEMGVKPEMAGRHTVRVRKVVAEVIPLLSLVVIFVMLAALSASILP
ANELLLVVALVAALVAALLWRWLIRVHTRMQIALLETLGNHPESPGH