Protein Info for Psyr_5055 in Pseudomonas syringae pv. syringae B728a

Annotation: YeeE/YedE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 12 to 12 (1 residues), see Phobius details transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details PF04143: Sulf_transp" amino acids 54 to 382 (329 residues), 244.8 bits, see alignment E=8e-77

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to psb:Psyr_5055)

Predicted SEED Role

"FIG00954845: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL90 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psyr_5055 YeeE/YedE (Pseudomonas syringae pv. syringae B728a)
MNNSLTATPGRKFGAPLAALFLLLMGAQFLLLSVGTRQVMLWIVGAALGVTLYHAAFGFT
SAWRVFIRERRGAGLRAQMVMLAVAVVLFFPALGAGTLFGQPVTGLVAPAGVSVVVGAFI
FGIGMQLGGGCASGTLFTAGGGNARMLVTLLFFILGSLIATHHVDWWFALPSFPAVSVVK
TFGVLPALLVNLALFGLIALVTVKLEKRRHGQLEVPPATDHRGLSRVLRGPWILVWGAVA
LALLNYATLALAGRPWGITSAFALWGAKAASGLGVDVGSWVFWQSAANAKALAAPVWEDI
TSVMDIGIMLGALLAAGLAGRFAPSLDIPTRSLVAAVIGGLLLGYGSRLAYGCNIGAYFS
GIASGSLHGWLWLVAAYAGNVIGVRLRPVFFTGERPQVALSGC