Protein Info for Psyr_5040 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details amino acids 492 to 515 (24 residues), see Phobius details amino acids 521 to 541 (21 residues), see Phobius details amino acids 555 to 573 (19 residues), see Phobius details amino acids 604 to 623 (20 residues), see Phobius details amino acids 652 to 673 (22 residues), see Phobius details amino acids 718 to 739 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 501 to 748 (248 residues), 28.4 bits, see alignment E=6.6e-11

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to psb:Psyr_5040)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLA5 at UniProt or InterPro

Protein Sequence (753 amino acids)

>Psyr_5040 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MDQISPPERIDFNTPAMVRKRRVRALKDRLTHWYVAIGGLAVLAAITLIFFYLAYVVAPL
FKGASLTAEPALHAAWLQDAGAPLMITIEEQNQIGMRISDKGEVVFFNLEDGAELQRIAL
PLPAGVSVASIGKDQPGAPLIALGLSNGQVLVFRHSYLTTYPNDQKTITPSVAWPYGEAP
LVLDEAGRAVEHVTVSSDGDSLKLAGSTGTQLHVVSLEQKENVMTGEMTREQTRIELPQM
SAVVKAIYIDPRQQWLYVINGRAQADVFSLRDRSLNGRYKLLEDGNAEITASAQLVGGIS
LIIGNSKGSLSQWFMARGTDGEQRLMRIRDFSLGSAPIAQIKAEQRRKGFIALDTSGKLG
VFHSTAHRTLLIDQVAEGPGILALSPRANRILIESAGKLLPLTLDNPHPEVSWSSLWGKV
WYENYDEPKYIWQSTASNSDFEPKLSLAPLTYGTLKAAFYAMLLAAPLAVAAAIYTAYFM
APGMRRKVKPVIELMEAMPTVILGFFAGLFLAPYLEGHLPGIFSVLLLTPIGILLAGFFW
TRVPDSLRLRIPDGWESAILIPVVLLVGWFSLSMSPHLESWFFAGDMSTWIRDHLGITYD
QRNALVVGIAMGFAVIPNIYSIAEDAVFSVPRSLTLGSLALGATPWQTLTRVVILTASPG
IFSALMIGMGRAVGETMIVLMATGNTPIMDMNLFEGMRTLAANVAVEMPESEVGGSHYRV
LFLAALVLLMFTFVMNTLAELIRQRLRKQYSSL