Protein Info for Psyr_5032 in Pseudomonas syringae pv. syringae B728a

Annotation: Response regulator receiver:Transcriptional regulatory protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 4 to 226 (223 residues), 361.1 bits, see alignment E=9.3e-113 PF00072: Response_reg" amino acids 6 to 117 (112 residues), 107.7 bits, see alignment E=3.6e-35 PF00486: Trans_reg_C" amino acids 151 to 225 (75 residues), 89.4 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 94% identical to PHOB_PSEAE: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 98% identity to pfo:Pfl01_5606)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLB3 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psyr_5032 Response regulator receiver:Transcriptional regulatory protein, C-terminal (Pseudomonas syringae pv. syringae B728a)
MAGRSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHAIIVDRKPDLILLDWMLPGT
SGIELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAV
LRRAGPTDGEAPIEVGGLLLDPISHRVTIDGKPAEMGPTEYRLLQFFMTHQERAYTRGQL
LDQVWGGNVYVEERTVDVHIRRLRKALGDAYENLVQTVRGTGYRFSTKS