Protein Info for Psyr_5028 in Pseudomonas syringae pv. syringae B728a

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF07992: Pyr_redox_2" amino acids 5 to 282 (278 residues), 165.9 bits, see alignment E=4.2e-52 PF00070: Pyr_redox" amino acids 145 to 219 (75 residues), 41.5 bits, see alignment E=4.8e-14 PF01593: Amino_oxidase" amino acids 157 to 240 (84 residues), 23.6 bits, see alignment E=9.1e-09 PF18113: Rbx_binding" amino acids 308 to 377 (70 residues), 91.1 bits, see alignment E=9.5e-30

Best Hits

Swiss-Prot: 78% identical to RURE_PSEAE: Rubredoxin-NAD(+) reductase (alkT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05297, rubredoxin-NAD+ reductase [EC: 1.18.1.1] (inferred from 100% identity to psb:Psyr_5028)

Predicted SEED Role

"Rubredoxin-NAD(+) reductase (EC 1.18.1.1)" in subsystem Rubrerythrin (EC 1.18.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLB7 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psyr_5028 FAD-dependent pyridine nucleotide-disulfide oxidoreductase (Pseudomonas syringae pv. syringae B728a)
MSAPVVIIGTGLAGYNLAREFRKLDVDTPLLLITADDGRSYSKPMLSTGFGKNKEADGLS
MAEAGAMADQLKAEIRTHTRISGIDAGHKRLWIGEEAVYYRDLVLAWGAETIRVPVEGDA
GDAVFPINDLQDYARFRAAAAGKRRVLILGAGLIGCEFANDLILGGYEVDLVAPCEQVMP
TLLPPEAAAAVKSGLESLGARFHLGPVLTRLNRNGDGLQAHLSDGQVMDCDLVVSAIGLR
PRIELAAAAGLQTGRGILVDRLLQTSHANIHALGDCAEVDGLNLLYVMPLMSCARALAQT
LAGNPTSVKYGPMPITVKTPACPLVVSPPPRGSDGHWSVEGQGADIKALCHDADGHLLGY
ALTGAAVMEKLALNKALPALLA