Protein Info for Psyr_5019 in Pseudomonas syringae pv. syringae B728a

Annotation: Acetyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF02550: AcetylCoA_hydro" amino acids 11 to 215 (205 residues), 97.2 bits, see alignment E=1.3e-31 TIGR03458: succinate CoA transferase" amino acids 12 to 494 (483 residues), 758.6 bits, see alignment E=1.3e-232 PF13336: AcetylCoA_hyd_C" amino acids 324 to 463 (140 residues), 144 bits, see alignment E=3.8e-46

Best Hits

Swiss-Prot: 51% identical to CAT1_CLOK5: Succinyl-CoA:coenzyme A transferase (cat1) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_5019)

MetaCyc: 51% identical to succinyl-CoA:CoA transferase (Clostridium kluyveri)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLC6 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Psyr_5019 Acetyl-CoA hydrolase (Pseudomonas syringae pv. syringae B728a)
MYRDRIRRPSLMSKVMSAADAAALIEDGMTVGMSGFTRAGEAKAVPHALAERAKVTPLKI
SLMTGASLGNDLDKQLTESGVLSRRMPFQVDSTLRKAINNGTVMFIDQHLSDTVELLRNR
QIKAVDLAVIECVAITEEGHLVLSTSVGNSASFAILAKQVIVEINLSQPLELEGLHDIYI
PSYRPTRLPIPVLEADSRIGSHAVKIDPAKIVGIVISNQPDSPSTVTPPDADTQAIANHL
VEFFKKEVREDRLTDKLMPLQAGIGNIANAVMHGLLASPFTDLTMYSEVLQDSTFDLFDA
GKLTFASGSSMTLSAAKHAEVFADFNRYKSRLVLRPQEISNHPEVIRRLGIIGINTALEF
DLYGNVNSTHICGTRMMNGIGGSGDFSRNAHLAIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARVIIDNCVHPDYRDALNAYLSAACAVGGHTPHILRE
ALSWHINLEETGRMLPA