Protein Info for Psyr_4988 in Pseudomonas syringae pv. syringae B728a

Annotation: YD repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF25023: TEN_YD-shell" amino acids 91 to 343 (253 residues), 81.7 bits, see alignment E=5.4e-27 TIGR01643: YD repeat (two copies)" amino acids 145 to 166 (22 residues), 18.5 bits, see alignment (E = 2.2e-07) PF03527: RHS" amino acids 266 to 300 (35 residues), 67.7 bits, see alignment 9.1e-23 TIGR03696: RHS repeat-associated core domain" amino acids 293 to 368 (76 residues), 97.4 bits, see alignment E=5.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4988)

Predicted SEED Role

"Rhs family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLF7 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Psyr_4988 YD repeat protein (Pseudomonas syringae pv. syringae B728a)
MSLVVGQLISDMERDDLHREVYRTQGKLTSCFGYDSMGRKAWQYATTLPAEKLSQIQNPL
IKPERYVEHAYNPIHRRYEYDPAGELSRTLDKLRGETQYEYEANGQLLARNTGRVVDGEE
FRYDAAANRLNFNTSRFDHVKDNRLRQWANHEYKYDAWGNLIEKTVGIVRWQTFTYDCEN
RLVKTETMADTQVESTSSYQYDSLGRRVAKQSEIKGHTGQKRFLWQGLRMLREESPGQSS
LYLYEPGSYAPLARVDEKEGEVENKVYYFHTDQIGTPLEMTDAEGQIVWQAKYRAWGAVE
KVVVNEVEQNLRFQGQYFDVETGLHYNTFRYYDPEIGRFITQDPIGLLGGENLYKYVPNP
TTWVDPWGWECWSTARKNYWKAEAKNPTQTYSPANMARMTKGQAPRMKVEVINRKTGKPE
IKDVSMELHHRDIPQRVGGDGVHQAGNLDALTPWAHESVAFRHTGYRFVDMIKGLDTWVK