Protein Info for Psyr_4964 in Pseudomonas syringae pv. syringae B728a

Annotation: OmpA/MotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details TIGR03348: type VI secretion protein IcmF" amino acids 19 to 559 (541 residues), 424.1 bits, see alignment E=7.1e-131 PF14331: IcmF-related_N" amino acids 188 to 444 (257 residues), 240.7 bits, see alignment E=2.6e-75 PF06761: IcmF-related" amino acids 498 to 643 (146 residues), 41.2 bits, see alignment E=2.2e-14 PF00691: OmpA" amino acids 715 to 806 (92 residues), 52.4 bits, see alignment E=8.4e-18

Best Hits

KEGG orthology group: K11891, type VI secretion system protein ImpL (inferred from 100% identity to psb:Psyr_4964)

Predicted SEED Role

"OmpA domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLI1 at UniProt or InterPro

Protein Sequence (830 amino acids)

>Psyr_4964 OmpA/MotB (Pseudomonas syringae pv. syringae B728a)
MNKIKYYFLRYQPYVLGVCFFLAIFIVWSIGRALGFSSMNSLLTGIGLFLLLSAAYVLLL
YRGVSQHQNLEGLLRDDADQAVLNASPADREEVSLLRERLLQSLERLQSNKPNGSNSKDA
LYALPWYLVVGQPAAGKSTMLYQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDT
AGRYMDDQEEAGKWRAFLQLLRQHRQRRPLNGLIVTVSIHDILQSSVEDQERIAKRLRER
IQETHALLEVRLPVYLVFTKCDLVPGFVPFYRQLDDVARGEVMGKTFPHKGFEQADWGQR
FGVAMDELINYWKQIANQQLVLQDIQVTRQDTAVYRFPLELEALKPRLLLFVDALLRANP
YQSAEMLRGFYFTSALDADQPEMGGHTRQVTERFQLESEQEAVDGNVQPHPLFINSLFRK
VIIPDQHLVALYTTNHRERRRKAAWIGGASLVALLLCSLWGWSYWNNKDNIQSISSELAQ
AAAEDSKATGQYTEWQTLDRMRFWTSLYYDRHHDEGVPLRLRLGLYRGYDVEPLLRTRYF
NRLETVMLKPTADNLTRSLYLLTTIKVYQRNAKDLMPVTGVDSVEPKALPPDNRAQSIAA
FGKATLDTYVMLSRAQREKADPAFLKAKMPDYWYPAIARQTGKTITANAEAGSNQDYEYA
SRQINFYSDQIHELDVPRILDNAFLTSSSRNYINSLLTQSLKAIETITLESDTLFAFGRA
DFQSLKTEGQNQLSAIAGKLLSTPNIGKIVIAGHADQLGDPQSNMQVSKQRAQTIKTYLV
GKGVPAELVDAIGEGSEKPLVKCDMQQPRAQLIQCLEPNRRVEIEVRALN