Protein Info for Psyr_4958 in Pseudomonas syringae pv. syringae B728a

Annotation: AAA ATPase, central region:Clp, N terminal:Clp, N terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 10 to 855 (846 residues), 1307.4 bits, see alignment E=0 PF02861: Clp_N" amino acids 21 to 73 (53 residues), 23.4 bits, see alignment 3e-08 amino acids 103 to 126 (24 residues), 9.6 bits, see alignment (E = 0.00062) PF00004: AAA" amino acids 225 to 355 (131 residues), 35.2 bits, see alignment E=9e-12 amino acids 604 to 722 (119 residues), 30.2 bits, see alignment E=3.1e-10 PF17871: AAA_lid_9" amino acids 365 to 464 (100 residues), 109 bits, see alignment E=5.7e-35 PF07724: AAA_2" amino acids 598 to 765 (168 residues), 192 bits, see alignment E=4.6e-60 PF07728: AAA_5" amino acids 603 to 724 (122 residues), 40.3 bits, see alignment E=1.7e-13 PF10431: ClpB_D2-small" amino acids 774 to 846 (73 residues), 46.8 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to psb:Psyr_4958)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLI7 at UniProt or InterPro

Protein Sequence (867 amino acids)

>Psyr_4958 AAA ATPase, central region:Clp, N terminal:Clp, N terminal (Pseudomonas syringae pv. syringae B728a)
MNLKSLFAKLNETSRTATESAAALCLSENHYDVEVEHLLLQLLDNNDNDLPVILRHYDVV
PDRLQAQLVTALGTFKKGNTRTPALSPHITRMIEQAWVLASIEFGQSQIRTGHLVQALLD
DDALRRVVIGSAPELEKINADDLRLNMSALVEGSPETKLSKPLANADASTGATTKGNGKT
PALDQYTVNLTQSARDGRIDPVLGREFEVRQMVDILTRRRQNNPILTGEAGVGKTAVVEG
LALRIVQGDVPSVLKGVAIHTLDLGLLQAGAGVKGEFENRLKSVIEETKRSLHPIILFID
EAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAALARRFQVVKV
EEPDEDKAIHMLRGLLAKMQEHHKVTVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARVALGQSAQPGALEDCKRHIDNLNAEITVLEQETAKGSDHARRLTALHEELQAEQETRE
SLEQQWKRELELVEKLGALSVPQSGEPDAGQIAAVRAELASVQGEQPLVHALVDGGTIGE
VISGWTGIPLGKMLRDEIDTVQSLPALLGERVLGQDHALEEIGKRIKISRARMEDPNKPI
GVFLLLGPSGVGKTETALALADTLYGGERNVITINMSEYQEAHTVSSLKGSPPGYVGYGE
GGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDGEGREINFRNTVIILTS
NTGTDRIMQWCLNTEQKPTPDDIVEGLRDELNQVFKPAFLGRLTIVPYYPVQDAILERIV
GLKLERIRKRFERNHQAVLRYDEALIKAIASRCTEVDSGARNIDNILSKTLMPELAQRVL
ERMAQDKPIQSLTIDLGSDGDFAYTLT