Protein Info for Psyr_4954 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF877

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR03355: type VI secretion protein, EvpB/VC_A0108 family" amino acids 24 to 495 (472 residues), 727.6 bits, see alignment E=3.4e-223 PF05943: VipB" amino acids 73 to 374 (302 residues), 471.5 bits, see alignment E=9.8e-146 PF18945: VipB_2" amino acids 384 to 494 (111 residues), 151.3 bits, see alignment E=1.1e-48

Best Hits

KEGG orthology group: K11900, type VI secretion system protein ImpC (inferred from 100% identity to psb:Psyr_4954)

Predicted SEED Role

"Uncharacterized protein ImpC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLJ1 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Psyr_4954 Protein of unknown function DUF877 (Pseudomonas syringae pv. syringae B728a)
MTDKQPVTQQDSALVEVENFAPQSSLLDSIISESRVARSETERTRTRDLIGELVAQVLEG
EMTPSKDLIAVLDARIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLK
IHLLNASKKDLVRDLKASSEFDQSALFKKIYEEEYGTFGGAPFGMLLGDYEFNRSPEDMY
LLEEISHVAAAAHAPFISAASAELFGWDSFTDMAGPRDLAKIFDTVEYAKWKSFRASEDS
RYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFSRY
GWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCK
GTDYAAFFGTQSTQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RKDVELFLNKWLSSYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQ
LDELTASLRLVAELPQSTRG