Protein Info for Psyr_4948 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-dependent DNA helicase, RecQ-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 52 to 71 (20 residues), see Phobius details TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 10 to 348 (339 residues), 365.7 bits, see alignment E=1.8e-113 PF04851: ResIII" amino acids 18 to 180 (163 residues), 23.9 bits, see alignment E=7.2e-09 PF00270: DEAD" amino acids 20 to 180 (161 residues), 80.2 bits, see alignment E=3e-26 PF00271: Helicase_C" amino acids 218 to 326 (109 residues), 79.3 bits, see alignment E=5.2e-26 PF16124: RecQ_Zn_bind" amino acids 514 to 561 (48 residues), 30.9 bits, see alignment 7.5e-11

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to psb:Psyr_4948)

Predicted SEED Role

"ATP-dependent DNA helicase RecS (RecQ family)"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLJ7 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Psyr_4948 ATP-dependent DNA helicase, RecQ-like protein (Pseudomonas syringae pv. syringae B728a)
MDGPRMHQRLEQVFGYTQFRPGQEAAISAVLAGRSAAAIFPTGSGKSLCYQLPALMLPHL
TLVVSPLLALIQDQLAFLHRHGISAASIDSAQSRDEIADVMARARSGELKILMISVERLK
NERFRNFIAQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQREFNIPQTLLLTATATPQ
VIIDMQDKFAIAPEDVITTGFYRANLHLWVKPVSGRDKRRRLVEWLNERRGQPTIVYVTL
QKTAEHIAAHLEQNGLPASAYHAGLPNDQRESIQKQFMGGHLNCIVATIAFGMGIDKSDI
RNVVHFDLPKSIENYSQEIGRAGRDGAASDCLVLANRDSLNVLENFVYGDTPEREGIARV
LEDLLGARHDGQWEFLLGPLADLSNIRQLPLKTLLVQLELRGIIAPRYAYFAEYRFKFLL
QPQDLMARFEGERREFVQALIDTSNRARTWATVDFEAMYQQYGAERGRVVKALDYFQEKG
WIELESKQMTEVYSLLRSDFDAQALSIELHDYFAHHEATEVARIHTMLDVFASDQCLTHR
LARYFGDHNAPERCGHCSVCLGEVAHLPEPPALEPLANRDFQQLCSEFIHKHQNYTGQPP
SADCLTRFLCGISVPLFTRLKARATTGFAVLEDYPYAQVRTWVQAMAGN