Protein Info for Psyr_4937 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 283 to 302 (20 residues), see Phobius details PF02743: dCache_1" amino acids 42 to 266 (225 residues), 57.5 bits, see alignment E=2.3e-19 PF00512: HisKA" amino acids 371 to 436 (66 residues), 40.8 bits, see alignment E=2.7e-14 PF02518: HATPase_c" amino acids 482 to 588 (107 residues), 75.8 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 66% identical to DCTB_PSEAE: C4-dicarboxylate transport sensor protein DctB (dctB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_4937)

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLK8 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Psyr_4937 ATP-binding region, ATPase-like:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MTMTPALPPRPRWRSLALLALCLAPLLWPLEHLAERYYRNVLANQNRQTLDLYVANLLGT
LHRYETLPQILGDLPALRAALAAPGDTPTLVNANRLLSEITRQTGADVMYLMDANGLTLA
ASNSDHKDSFIGRNFSFRPYFIDARAGRTGRFFGLGTTSAKRGYFFAGPVRDGERIIGVL
VVKVDLDHTETLWGKTPEQLLLTDQNGVVILTSNPEWRFRATRDLTDDEKKAIVAIQSYP
TRDPRPLRIDENAWLTQTQAIEETGWNVNILAPRALVDRQVRTVVAIGGAALLVLMLLLG
LMMQRRRHYLDRIAFEAKARRELEMRVIERTSDLEGLNSRLRQEVLEREQAQQELVQAQD
ELVQTSKLTALGTMSASISHELNQPLAAIRSYAENAEVLLDHQRTEDARGNLKLISELTG
RMASIIAHLRAFARRDRHAPESVALQPALEDALALLAKRRRAMEVELIRDLPDATIWVQA
GETRLRQVLGNLIANALDALTEKGPPRRLWISVEQTAEGVNLYIRDNGPGFSQEALARAR
EPFFTTKTRTQGLGLGLAICDTLMRALGGELLFANHPSGGALLTLRLRAGASGANLQPPE
DLSA