Protein Info for Psyr_4936 in Pseudomonas syringae pv. syringae B728a

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase" amino acids 2 to 177 (176 residues), 275.5 bits, see alignment E=8.5e-87 PF00908: dTDP_sugar_isom" amino acids 6 to 176 (171 residues), 253.1 bits, see alignment E=5.6e-80

Best Hits

Swiss-Prot: 64% identical to RMLC_PSEAE: dTDP-4-dehydrorhamnose 3,5-epimerase (rmlC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to psb:Psyr_4936)

MetaCyc: 61% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLK9 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Psyr_4936 dTDP-4-dehydrorhamnose 3,5-epimerase (Pseudomonas syringae pv. syringae B728a)
MNVVATKLPEVLILEPKVFGDERGFFYESFNAKAFQAATGLTREFVQDNHSRSQQGVLRG
LHYQIENAQGKLVRVTVGKVLDVAVDIRRSSPNFGQWVGVELSAENARQLWVPEGFAHGF
VVLSEHAEFLYKTTDYYTPSAERCIAWDDADLAIDWQFDGQPNLSAKDQQGKRLKEADLF
P