Protein Info for Psyr_4917 in Pseudomonas syringae pv. syringae B728a

Annotation: Heat shock protein DnaJ, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 138 to 157 (20 residues), see Phobius details amino acids 270 to 279 (10 residues), see Phobius details PF00226: DnaJ" amino acids 6 to 67 (62 residues), 69.8 bits, see alignment E=8.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4917)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLM8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Psyr_4917 Heat shock protein DnaJ, N-terminal (Pseudomonas syringae pv. syringae B728a)
MQRTPTHYELLSVARDASPEQIKKAYRKLAQKLHPDRNPDPYASDMMGVVNASHDVLADP
SRRAAYDAQLAANEHKARIDAARRKQAHATRGQAVHVYDATSTAATSAPSQAARSGPAPK
SSSYASASPSRDRRRRSAWRWALLFVVFCAGGAWMGYEPGAGKSFVPSEPAPVAQTWVKP
APAMPVTPVEEPVASPAKSVDAAASECGVPALDPMGAPWPDKAGYVKDMPVLKDNGWSQI
TVDNSAGESAVYAKVTDAVGRRAFRHAFVPAGAVFVFAKMDPGLYLLKYKMMSTGCAFAS
GRILLEETPMGSQIKSSAYKLTLRKLQNRSVPFARLKDDQF