Protein Info for Psyr_4914 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 116 (107 residues), 80.7 bits, see alignment E=4.6e-27 PF00528: BPD_transp_1" amino acids 35 to 222 (188 residues), 77.2 bits, see alignment E=7.1e-26

Best Hits

Swiss-Prot: 48% identical to OCCM_RHIML: Octopine transport system permease protein OccM (occM) from Rhizobium meliloti

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_4914)

MetaCyc: 40% identical to L-arginine ABC transporter membrane subunit ArtM (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLN1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psyr_4914 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a)
MNWEVIIKWLPRLAQGATLTLELVAIAVIAGLILAIPMGIARASRHWPVRALPYAYIFFF
RGTPLLVQLFLVYYGLAQFESVRQSALWPYLRDPFWCAVVTMTLHTAAYIAEILRGAMQA
VPPGEVEAARALGMSKWKALFYIVLPRAARIGLPAYSNEVILMLKASALASTVTLLELTG
MARTIIARTYLPVEIFFAAGMFYLVMTFVLVQGFRLLEKLLRVDASQGR