Protein Info for Psyr_4913 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 1, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 117 (108 residues), 69 bits, see alignment E=2.1e-23 PF00528: BPD_transp_1" amino acids 31 to 223 (193 residues), 86.1 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_4913)

Predicted SEED Role

"Arginine ABC transporter, permease protein ArtQ" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLN2 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Psyr_4913 amino acid ABC transporter membrane protein 1, PAAT family (Pseudomonas syringae pv. syringae B728a)
MNIDLHGFGPALAAGALMTVQLALSALCLGLVLGLLGALAKTSPYKPLQWLGSTYSTLVR
GIPELLWVLLIYFGTVNGMRALGKLFDIPDLALSAFAAGVIALGICFGAYATEVFRGAIL
AIPKGHREAGLALGMSRSRILFKLVLPQMWRIALPGLGNLFMILMKDTALVSVIGLEEIM
RHAQIAVGFTKQAFTFYMVAAFMYLGLTVLAMAGMYFLEKRASRGFLRSAS