Protein Info for Psyr_4901 in Pseudomonas syringae pv. syringae B728a

Annotation: A/G-specific DNA-adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 114 to 130 (17 residues), see Phobius details TIGR01084: A/G-specific adenine glycosylase" amino acids 5 to 277 (273 residues), 368 bits, see alignment E=1.8e-114 PF00730: HhH-GPD" amino acids 35 to 166 (132 residues), 81.9 bits, see alignment E=6.1e-27 PF14815: NUDIX_4" amino acids 237 to 343 (107 residues), 81.5 bits, see alignment E=6.3e-27

Best Hits

Swiss-Prot: 55% identical to MUTY_ECOLI: Adenine DNA glycosylase (mutY) from Escherichia coli (strain K12)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to psb:Psyr_4901)

MetaCyc: 55% identical to adenine DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2661 [EC: 3.2.2.31]

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLP4 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Psyr_4901 A/G-specific DNA-adenine glycosylase (Pseudomonas syringae pv. syringae B728a)
MQPEQFSSAVLDWYDRHGRHDLPWQQDITPYRVWVSEIMLQQTQVSTVLSYFDRFMEALP
TVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAEHGGEFPRDVEKLILLPGIGLS
TAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFTPHSRVNNY
TQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKRTLMPMLAN
EDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLIHTFSHFQL
SIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAADVLNAGESS