Protein Info for Psyr_4899 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 387 to 412 (26 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 525 to 545 (21 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 440 (398 residues), 103.3 bits, see alignment E=6.7e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4899)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLP6 at UniProt or InterPro

Protein Sequence (553 amino acids)

>Psyr_4899 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSTSTALGGEAVQPAFLSKERIIAKPGFNRWLVPPAALAIHLCIGMAYGFSVFWLPLSKA
IGVTAPVACTPDMGFFAQMFASTCDWQISMLGWIYTLFFIFLGCSAAIWGGWLEHAGPRK
AGVVSALCWCGGLLISALGIYTHQIWLMWLGSGVIGGIGLGLGYISPVSTLIKWFPDKRG
MATGMAIMGFGGGAMVGAPLATALMGHFASAESVGVWQSFVVMAVIYFIFMIGGALGYRV
PPTGWKPEGWTAPAAKAKNSMITNRHVHVSVAWKTPQFRLVWLVLCLNVSAGIGILGMAS
PLLQEVFAGKLLGVDLTFSQLNADQLKAIAAIAAGFTGLLSLFNIGGRFFWASCSDFIGR
KATYFVFFALGFLLYASVPTLSHMGSIALFVAAFCIVLSMYGGGFATVPAYLADLFGTQM
VGAIHGRLLTAWAAAGVLGPVLVNYLREYQLAHGVARADAYDITLYILSGLLVLGFICNL
LIRPVADKYFMTDAELAAEQAIGHDKGANATTSLEWKASDSSKPLVIAAWLAVGIPLAWG
VWITLQKTAVLFH