Protein Info for Psyr_4887 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase S41A, C-terminal protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF22694: CtpB_N-like" amino acids 46 to 98 (53 residues), 36.5 bits, see alignment 1.3e-12 TIGR00225: C-terminal processing peptidase" amino acids 68 to 387 (320 residues), 354.8 bits, see alignment E=2.2e-110 PF00595: PDZ" amino acids 113 to 181 (69 residues), 37.1 bits, see alignment E=8.7e-13 PF13180: PDZ_2" amino acids 114 to 185 (72 residues), 45.6 bits, see alignment E=1.8e-15 PF17820: PDZ_6" amino acids 129 to 183 (55 residues), 50 bits, see alignment 5e-17 PF03572: Peptidase_S41" amino acids 212 to 377 (166 residues), 197.6 bits, see alignment E=2.7e-62

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to psb:Psyr_4887)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLQ8 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_4887 Peptidase S41A, C-terminal protease (Pseudomonas syringae pv. syringae B728a)
MLHLSRLTSLALAIAIVIGAPLAQAAEKTAPATPAAVSPAKTNATAKPPLPLDELRTFAE
VMDRVKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFQELQESTSGEFGGLGIEV
GVEDGFVKVVSPIDDTPASKAGIEAGDLIVKINGTPTQGQNMQEAVDKMRGKIGEKITLT
LVRDGGTPFDVTLARATIQVKSVKAQMLENGYGYIRITQFQVKTGDEVGKALAKFRKDNG
KKMSGLILDLRNNPGGVLQSAVQVADHFLTKGLIVYTKGRIANSELRFSADPADASEGVP
LVVLINGGSASASEIVAGALQDQKRGILMGTDTFGKGSVQTVLPLNNDRALKITTALYYT
PNGRSIQAQGINPDIVVRRAKVTNEADGENYKEADLLGHLGNGNGGADKPTVKSGAAAKA
RPQDDDFQLSQALSLLKGLSITRGN