Protein Info for Psyr_4877 in Pseudomonas syringae pv. syringae B728a
Annotation: 1-Cys peroxiredoxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to PRDXL_DICDI: 1-Cys peroxiredoxin (DDB_G0282517) from Dictyostelium discoideum
KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4877)Predicted SEED Role
"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZLR8 at UniProt or InterPro
Protein Sequence (212 amino acids)
>Psyr_4877 1-Cys peroxiredoxin (Pseudomonas syringae pv. syringae B728a) MTLRLGDIAPDFEQESSEGRIRFHEWLGDSWGVLFSHPADFTPVCTTELGFTAKLKDEFA KRGVKAIALSVDPVDSHIKWIDDINTTQNTLVNFPILADADRKVSDLYDLIHPNANDTLT VRSLFVIDPNKKVRLTITYPASTGRNFHEILRVIDSLQLTDNYKVATPANWVDGDDVVIV PSIKDEAEIKQRFPKGYKAVTPYLRLTPQPNR