Protein Info for Psyr_4876 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter, substrate-binding protein, aliphatic sulfonate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13379: NMT1_2" amino acids 27 to 255 (229 residues), 53.6 bits, see alignment E=7.3e-18 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 31 to 312 (282 residues), 257.3 bits, see alignment E=8.3e-81 PF12974: Phosphonate-bd" amino acids 50 to 187 (138 residues), 37.3 bits, see alignment E=5e-13 PF04069: OpuAC" amino acids 52 to 232 (181 residues), 52.3 bits, see alignment E=1.5e-17 PF09084: NMT1" amino acids 55 to 249 (195 residues), 71.6 bits, see alignment E=2.3e-23 PF16868: NMT1_3" amino acids 99 to 210 (112 residues), 27.8 bits, see alignment E=4.9e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_4876)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLR9 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Psyr_4876 ABC transporter, substrate-binding protein, aliphatic sulfonate (Pseudomonas syringae pv. syringae B728a)
MRTVILRRGLVALFAAAVALGAVTQAQAEDLRIGYQKYGTLVLLKAKGSLEKRLAEQGVK
VQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYVAYEPPAPTSEAILVPK
DSPITSVKDLKGKKVVLNKGSNVHYLLVKALEDAGLKYTDIQTVFLPPADARAAFERGSV
DAWVIWDPYQAAAEKQLQARTLKDGTGIVDNHQFYLATKPYAQKNPKVIQALVEEVRAVG
EWSKANPDEVTRQVAPLLGLPADITLTSVKRQGYGAQFLTPPVVAAQQKIADTFYQLKLI
PKPLSIADVVWTPPAAVAQAQ