Protein Info for Psyr_4867 in Pseudomonas syringae pv. syringae B728a

Annotation: L-glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 360 to 378 (19 residues), see Phobius details PF00120: Gln-synt_C" amino acids 115 to 446 (332 residues), 365.3 bits, see alignment E=1.6e-113

Best Hits

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to pst:PSPTO_5309)

Predicted SEED Role

"glutamine synthetase family protein" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLS8 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psyr_4867 L-glutamine synthetase (Pseudomonas syringae pv. syringae B728a)
MSTNLDQLTDWLKEHKITEVECMMSDLTGITRGKISPTNKFIAEKGMRLPESVLLQTVTG
DYVEDDIYYELLDPADIDMICRPDQNAVYLVPWAVEPTAQVIHDTYDKQGNPIELSPRNV
LKKVLKLYADQGWQPIVAPEMEFYLTKRSDDPDYPLQPPIGRSGRPETGRQSFSIEAANE
FDPLFEDVYDWCELQNLDLDTLIHEDGTAQMEINFRHGDALSLADQILVFKRTMREAALK
HDVAATFMAKPMTGEPGSAMHLHQSIIDIETGKNIFSNEDGTMSELFLNHVGGLQKFIPE
LLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDAVPQNRRVENRLPGADANPY
LAIAASLLCGFIGMVEGINPSAPVVGRGYERRNLRLPLTIEDALERMENSKTIEKYLGKK
FIIGYVAVKRAEHENFKRVISSWEREFLLFAV