Protein Info for Psyr_4843 in Pseudomonas syringae pv. syringae B728a
Annotation: NUDIX hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RPPH_PSESM: RNA pyrophosphohydrolase (rppH) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 100% identity to pst:PSPTO_5285)MetaCyc: 66% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-
Predicted SEED Role
"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.6.1.-
Use Curated BLAST to search for 3.6.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZLV2 at UniProt or InterPro
Protein Sequence (159 amino acids)
>Psyr_4843 NUDIX hydrolase (Pseudomonas syringae pv. syringae B728a) MIDPDGFRPNVGIILTNDAGQVLWARRINQDAWQFPQGGINPQETPEDALYRELNEEVGL ERHDVQILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRLISNEQRVRMDLTGKPE FDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLSRD