Protein Info for Psyr_4835 in Pseudomonas syringae pv. syringae B728a

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 268 to 288 (21 residues), see Phobius details TIGR01224: imidazolonepropionase" amino acids 21 to 396 (376 residues), 482.3 bits, see alignment E=4.3e-149 PF01979: Amidohydro_1" amino acids 57 to 374 (318 residues), 74.9 bits, see alignment E=7.5e-25 PF07969: Amidohydro_3" amino acids 104 to 375 (272 residues), 62.3 bits, see alignment E=6.2e-21

Best Hits

Swiss-Prot: 100% identical to HUTI_PSEU2: Imidazolonepropionase (hutI) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 100% identity to psb:Psyr_4835)

MetaCyc: 81% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLW0 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Psyr_4835 imidazolonepropionase (Pseudomonas syringae pv. syringae B728a)
MKTLWKNCHIASMAHGKYSIIEDAAIVTSGALIEWIGPQAALAEPEHDNCIDLDGAWVTP
GLIDCHTHTVFGGNRSGEFEQRLQGVSYAEIAAAGGGIASTVRATRAASEDELYASAERR
LRHLLKDGVTTVEMKSGYGLDLENERKILRVIRRLGNTQPVTVRATCLAAHALPPEYADR
ADDYINHICNDMLPALAAEGLVDAVDAFCEYLAFSPAQVEQVFITAGQLALPVKLHAEQL
SSLGGSSLAARYKALSADHLEFMTEDDAIAMAAAGTVAVLLPGAFYFLRETQLPPMDALR
KHGVPIAISTDLNPGTSPGLSLRLMLNMACTLFRMTPEEALAGVTFNAARALGMSATHGS
LEVGKVADFVAWNIERPADLAYWLGGDLDKRIVRHGVESSI