Protein Info for Psyr_4826 in Pseudomonas syringae pv. syringae B728a

Annotation: TonB-dependent receptor:TonB box, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 PF07715: Plug" amino acids 73 to 181 (109 residues), 67.9 bits, see alignment E=1.6e-22 PF00593: TonB_dep_Rec_b-barrel" amino acids 261 to 719 (459 residues), 161.8 bits, see alignment E=7.7e-51 PF14905: OMP_b-brl_3" amino acids 535 to 749 (215 residues), 33.7 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4826)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLW9 at UniProt or InterPro

Protein Sequence (755 amino acids)

>Psyr_4826 TonB-dependent receptor:TonB box, N-terminal (Pseudomonas syringae pv. syringae B728a)
MHTTGGDSVRHTLLAQAIDQAHTARGRRCGWLLMGLTALPCVPAMAETAAGQNTETVALE
SVTVTATRREESLQKVPVAVSVIEGEQLERDNRNGVASIVQQVPSLNFRTGASNKDTSLF
VRGVGTISTSPGVEPTVATVIDGVVYARPGQATLDLLDLERIEVLRGPQGTLFGKNASAG
VLNVTTKAPTEATHGYIDQSYYSGNESRTRFGIGGSLIPQTLKGSITTLFGSYDGNVDNK
LNGQEVNGYNRKGARGKLEFTPNDDITFTLAADYMQSHDDAPNGVVTKALTPSFASALTP
VRADSDNRNVVSDYRSHVEDVNKGLSGQLDWQLGDYTLTSITAWRGWDNTQYQDGDRLGT
VTAAFPGTEDKGDLAFNQYSQELRLASPKGRFVEYVGGLFYMHGKSDETYQRTLITPTTH
DRGIADYSTTTDSYSVFGETTFNFTPDLRAIAGARWTHDDLEYDHRRVSTSATTVSGIQP
ATSSSGSVDEDGKSGRLGLQYDLSDSVMTYITYSRGYKGPAYNVFFNMQPRDTEALKPET
SNTWEVGLKATTWNNRLTTNLAVFHSEYDNYQANFFDSVAGQVVTRLINAGSVSTEGVEL
DYALQATRNLKFSGALSYTKARIDSFACPAGAAASCNVDGKTLPYSPDWKSYVRADYTIP
LDNGLDIELGTDYSWQSEVQYDISQNPDTRQGAYGIWNASVALADYNSGWRVALLGKNLA
DKSYSPMLATGGNYVYRSVPRDDERYFGVQLRKDF