Protein Info for Psyr_4825 in Pseudomonas syringae pv. syringae B728a

Annotation: xenobiotic compound monooxygenase, DszA family, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 10 to 431 (422 residues), 601.3 bits, see alignment E=4.8e-185 PF00296: Bac_luciferase" amino acids 21 to 387 (367 residues), 174.7 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 56% identical to YXEK_BACSU: Putative monooxygenase YxeK (yxeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4825)

MetaCyc: 56% identical to N-acetyl-S-(2-succino)-L-cysteine monooxygenase monomer (Bacillus subtilis subtilis 168)
1.14.13.M85 [EC: 1.14.13.M85]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLX0 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Psyr_4825 xenobiotic compound monooxygenase, DszA family, A subunit (Pseudomonas syringae pv. syringae B728a)
MSTTARQMKLGAFLMATGHHVAAWRHPDVPADAGLDFKHYRHVARVAEAAKFDALFVADS
VAAATGDIASRMARSDHFEPLTLLSALSAVTEHIGLIATATTTYNEPYHVARKFASLDHL
SGGRAGWNLVTSDAAAEAQNFGRAEHVGHAERYSRAREFHQVVTGLWDSWADDAFTRDKA
SGEYYDPAKMHVLDHQGEHFRVKGPLNVARSPQGQPVVVQAGSSEVGRDLAAQTAEVVFT
AQTSLASAQAFYADIKGRLRAFGRDADSLKIMPGVFIVVAETEALAKAKFESFQELVEPQ
VGVALLGRMLGNFDLSGYPLDGPLPELPLTDSGQRSRQKLLTELADQENLTLAQLGRRIA
GGRGHYSLIGTPEQIADELQRWLEQGAADGFNVLVPHLPGGLEDVAQLLVPELQRRGLFR
TEYEGTTLRENLGLQRPAYRF