Protein Info for Psyr_4802 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 100 to 412 (313 residues), 170.2 bits, see alignment E=2.7e-54 PF25973: BSH_CzcB" amino acids 124 to 267 (144 residues), 95.8 bits, see alignment E=3.5e-31 PF25917: BSH_RND" amino acids 124 to 263 (140 residues), 31.5 bits, see alignment E=3.9e-11 PF25893: HH_CzcB" amino acids 163 to 222 (60 residues), 86.5 bits, see alignment E=2.8e-28 PF25954: Beta-barrel_RND_2" amino acids 270 to 346 (77 residues), 38.1 bits, see alignment E=4.5e-13 PF25967: RND-MFP_C" amino acids 351 to 407 (57 residues), 22.3 bits, see alignment 3.1e-08 PF25975: CzcB_C" amino acids 352 to 412 (61 residues), 87.8 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4802)

MetaCyc: 67% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLZ3 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Psyr_4802 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MNNKRSIAIALAVVVIMGLGSLTLNPQMLPFAAGPKPSAEEHAHDAEQGHSEEPGHADEQ
GHGNEAKKPDAAASESSHEEEEEGHIELTAEQIKAAGIELTSAEPRQMSTTVTFPGEIRF
DEDRTAHVVPRVSGVVEAVKVDLGQAVKKGQVLAVIASQQISDQRSELNAAQRRQELARL
TLQREKKLWEDRISAEQDYLQARQDFQEADINLANARQKISAIGASTHPSAGSRYELIAP
FDAVVVEKHLGIGEMVSEASNAFTLSDLSRVWATFGVAPRDLDKVVVGRPVIISAPDLNA
RVEGRVGYVGSLLGEQTRAAAVRVTLANPQGAWRPGLFVSVEVAAEQSSVAVSLPESAIQ
SVEDKPSVFVRNAEGFQLTPVTLGRRDGGHVEIVKGLAAGTQVATAGSFILKSELGKGSA
EHAH