Protein Info for Psyr_4767 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase U62, modulator of DNA gyrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF01523: PmbA_TldD_1st" amino acids 24 to 86 (63 residues), 27.7 bits, see alignment E=3.8e-10 PF19289: PmbA_TldD_3rd" amino acids 237 to 475 (239 residues), 97.7 bits, see alignment E=8.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4767)

Predicted SEED Role

"TldD family protein, Beta/Gamma-proteobacterial subgroup" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM28 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Psyr_4767 Peptidase U62, modulator of DNA gyrase (Pseudomonas syringae pv. syringae B728a)
MFDFSARLKQHFAALQSEAQFFSVRYVHRTGQRLCVRKNVAEPPSLISDEGAMLTVRLNG
VEAYAATNDISLKGLQAALQQAEALARRLAPHALLDLSDQAVSSAKADYLSPNMDRAFPP
LSDCIGLLMAESSAVPADERLVNWQAILDLETVEQIYLNSAGAELSQAQRFVFPGMSVTA
YDGRDSQTRTLGGHNFGQQGGIEVLSSCGLIGSAATVADEALQLILAPNTPSGPRDLLLM
PDQMVLQIHESIGHPLELDRILGDERNYAGTSFVKTTDFGTLQYGSSLLNVTFDPEIPEQ
LASYAHDDDGTSASKQFLIRDGLLQRPLGGALSQYRSGLAGVANSRASSWNRAPIDRMAN
LNIEPGDQSLDSLIGNIEHGILMSSNRSWSIDDARNKFQFGCEWGQLIENGELKGVVKNP
NYRAISAQFWKNLSAVGDASTFKVLGTPNCGKGEPNQVIRVGHASPACVFANVDVFGGDA