Protein Info for Psyr_4766 in Pseudomonas syringae pv. syringae B728a

Annotation: L-threonine aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF01212: Beta_elim_lyase" amino acids 7 to 297 (291 residues), 247.2 bits, see alignment E=1.1e-77

Best Hits

Swiss-Prot: 89% identical to LTAE_PSEUN: Low specificity L-threonine aldolase (ltaE) from Pseudomonas sp. (strain NCIMB 10558)

KEGG orthology group: K01620, threonine aldolase [EC: 4.1.2.5] (inferred from 100% identity to psb:Psyr_4766)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.5

Use Curated BLAST to search for 4.1.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM29 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Psyr_4766 L-threonine aldolase (Pseudomonas syringae pv. syringae B728a)
MTDQSQQFASDNYSGICPEAWAAMEQANKGHQRAYGDDQWTARASDDFRRLFETDCEVFF
AFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTARSAGGKLTPE
SIREVALKRQDIHYPKPRVVTLTQATEVGGVYQPEELKAISATCKELGLHLHMDGARFSN
ACAFLEASPAELTWKSGVDVLCFGGTKNGMAVGEAILFFDHDLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLENDAWLKHARHANRCAQLLAELVKDIPGVELMFPVQANGVFLQLSEPA
IAALTARGWRFYTFIGNGGARFMCSWDTEEDRVRELAADIRLVMQG