Protein Info for Psyr_4765 in Pseudomonas syringae pv. syringae B728a

Annotation: TraX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 34 to 35 (2 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 130 to 158 (29 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details PF05857: TraX" amino acids 16 to 242 (227 residues), 227.6 bits, see alignment E=8e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4765)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM30 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psyr_4765 TraX (Pseudomonas syringae pv. syringae B728a)
MDLSNPPFLPGRNKALDLLKWLTMLSMVLDHLRYVGWSVDFLYVPGRFAFPWFCLAIAVN
LSRRSAAIVAPRVQWRYLGWLLAFAGLAEIPYRLFMADATVLNVMPTLLLGLVIAQGWQH
RNPTTRVMALVALLLTAIFQKYLMFGFAGVLLPLVFVLVLEKRLWYAVFPAVFCLAGNAW
SQMVAGASWGDPISIGSIVACVLAPVLGIALLRAKPGFAVIPMRRWAYAIYPLHFLLLLG
LRMVLGRG