Protein Info for Psyr_4763 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase C56, PfpI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18011: Catalase_C
  • amino acids 7 to 128 (122 residues), 26.2 bits, E=5.4e-10
• PF01965: DJ-1_PfpI
  • amino acids 8 to 175 (168 residues), 169.1 bits, E=7.6e-54
• TIGR01382: intracellular protease, PfpI family
  • amino acids 10 to 177 (168 residues), 167.4 bits, E=1e-53

Best Hits

Swiss-Prot: 39% identical to DEGLY_PYRFU: Deglycase PfpI (pfpI) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 100% identity to psb:Psyr_4763)

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.-

Sequence Analysis Tools

See Q4ZM32 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Psyr_4763 Peptidase C56, PfpI (Pseudomonas syringae pv. syringae B728a)
MSKALTGKRIAILVTDGFEQVELTGPKEALEQAGATVEILSAEEGKVKGWNHDKPADDFK
IDGTFKAANASDYHGVVLPGGVQNSDTIRIDSDAQKIVKDIEAAGKPVAVICHGSWLLIS
AGLVKGKTLTSFKTLKDDLVNAGAKWVDQEVVTDGKLISSRQPDDIPAFNSKLIEALSA