Protein Info for Psyr_4749 in Pseudomonas syringae pv. syringae B728a

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 67 to 89 (23 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF18075: FtsX_ECD" amino acids 104 to 195 (92 residues), 59.3 bits, see alignment E=4.7e-20 PF02687: FtsX" amino acids 221 to 336 (116 residues), 32.8 bits, see alignment E=6e-12

Best Hits

Swiss-Prot: 81% identical to FTSX_PSEPU: Cell division protein FtsX (ftsX) from Pseudomonas putida

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to psb:Psyr_4749)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM46 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Psyr_4749 cell division protein FtsX (Pseudomonas syringae pv. syringae B728a)
MSATRSPKVSERVAPKAADPVPPKQKKQRHDHDDDGPDFSALLSAWLESHRSSLLDSLRR
LGKQPIGSFFTCLVMAIALSLPMGLSLLLSNVERLGGSWQRAAQISIYLNLDASTADGTR
LRDEIKAMPGVADAEYISSEQALGEFKQQSGLGEALKELPENPLPGVVLVTPDEVDKPAL
EALRTRLAELPKVEQAQLDLVWVERLAAILKLGDRFVFGLTVLLVSALLLVIGNTIRLHI
ENRRIEIEVIKLVGGTDSYVRRPFLYMGALYGFGAGILSWGVLAYGLNWLNGAVVGLAGL
YGSDFALAGVPMGDGLSLLLGAVLLGYIGAWIAVARHLRELAPR