Protein Info for Psyr_4736 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 72 to 92 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 170 to 195 (26 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF11067: DUF2868" amino acids 145 to 442 (298 residues), 352 bits, see alignment E=1.8e-109

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4736)

Predicted SEED Role

"probable integral membrane protein NMA1899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM59 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Psyr_4736 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MTALTPLDTLWLTEAVRLREQQAGVLDDLEANRRARAAGGDLTARITHRALGLAQRDGMF
GALHHWKQGARLALIALAVLAVISGAGLAFAAMGDGQAPVNVFWALGSLLGLNLVLLLTW
ALGLIFAGRSNTGLGRVWLWLSEKLARDAQAAQLAPALVLLLQRQRLNRWALGLVVHSLW
LLALLTALLLLLMLMATRRYGFVWETTILSSDTFVSLTQTLSTVPAWLGFSVPDETMIRA
SGNGALSIENARQAWAAWLVGVLLVYGIVPRLLLAGFCLWRWKQGRAALRLDLDLPEYLE
LRERLMPSSERLGVNDAEPAALHQVQSGLGAVESNGALLVAIELDDQQVWPPALPSGVAD
AGILDSRESRHKLLEQLTQYPPARMLIACDPRRSPDRGSLALIAELARCAGATRIWLLPA
PAGQRLDPERLGDWHVALDQLQLPHADTVPLNWLETGHD