Protein Info for Psyr_4684 in Pseudomonas syringae pv. syringae B728a

Annotation: biotin synthesis protein BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF01209: Ubie_methyltran" amino acids 18 to 151 (134 residues), 36.8 bits, see alignment E=8.3e-13 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 22 to 268 (247 residues), 254.8 bits, see alignment E=5e-80 PF13489: Methyltransf_23" amino acids 43 to 197 (155 residues), 47 bits, see alignment E=7.2e-16 PF13847: Methyltransf_31" amino acids 56 to 167 (112 residues), 54.4 bits, see alignment E=3.9e-18 PF08241: Methyltransf_11" amino acids 58 to 151 (94 residues), 76.6 bits, see alignment E=6e-25 PF08242: Methyltransf_12" amino acids 58 to 149 (92 residues), 43.8 bits, see alignment E=1.1e-14 PF13649: Methyltransf_25" amino acids 58 to 147 (90 residues), 62.7 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 70% identical to BIOC_PSEA7: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to psb:Psyr_4684)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMB1 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psyr_4684 biotin synthesis protein BioC (Pseudomonas syringae pv. syringae B728a)
MTDLSIPKPPSVLPDKRQVAASFSRAAGSYDSVAELQRNVGNELLARLPAQCKPSRWLDL
GSGTGHFSRALAQTFSGSEGIALDIAEGMLRHAQPLGGAQHFVAGDAEHLPLREQSCGLI
FSSLAVQWCADFAAVLSEARRVLQPGGVFAFASLCVGTLYELRDSWQAVDGRVHVNRFRH
EDDYRQLCAASGLQVRSLDVRPQVLHYPDVRSLTHELKALGAHNLNPGRPNGLTGRERIM
GMVQAYEDFRQDAGLPATYQVLYAVLEKN