Protein Info for Psyr_4677 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 525 to 534 (10 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 39 to 158 (120 residues), 45.6 bits, see alignment E=2.2e-15 PF02770: Acyl-CoA_dh_M" amino acids 163 to 272 (110 residues), 44.5 bits, see alignment E=3.5e-15 PF00441: Acyl-CoA_dh_1" amino acids 283 to 451 (169 residues), 58.6 bits, see alignment E=2.1e-19 PF22924: ACOX_C_alpha1" amino acids 293 to 447 (155 residues), 27.5 bits, see alignment E=6.4e-10 PF12806: Acyl-CoA_dh_C" amino acids 468 to 585 (118 residues), 121.7 bits, see alignment E=5.3e-39

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to psb:Psyr_4677)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMB8 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Psyr_4677 Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region (Pseudomonas syringae pv. syringae B728a)
MADYKAPLRDMRFVLNEVFEVSKLWAQLPELAETVDVETVEAILEEAGKVTSKTIAPLSR
NGDEEGCHWKDTVVTTPAGFPEAYKIYAEGGWVGVGGNPEFGGMGMPKVVSAQVEEMLNS
ASLAFGLYAMLTSGACVSIDTHATEELKNKFLPNMYSGVWAGSMCLTEAHAGTDLGIIRT
RAEPQADGAYQITGSKIFITGGEHDLTENIIHLVLAKLPDAPPGPKGISLFLVPKFMVGD
DGSLGERNTVSCGSIEHKMGIQASATCVMNFDAATGYLIGEPNKGLAAMFTMMNYERLGV
GIQGLASGVRSYQAAVEYAQDRLQSRAPTGAQNKDKAADPIIVHPDVRRMLLTMKAFNEG
GRAFSSYVALQLDIAKFSEDDTARKRADDLAALLTPVSKAFLSDIGLETTVHGQQVFGGH
GYIREWGQEQLVRDVRITQIYEGTNGIQALDLVGRKIVGSNGAFYQLFSDEVRQFITGSD
NALSEFTQPLSKALNMLDELTGWVLDRSRNNPNEIGAASVEYLHLFGYTAYAYMWAMMAK
AALGKEQQEEFYASKLGTARFYFARLLPRIHSLDASVRAGSESLYLLKASQF