Protein Info for Psyr_4674 in Pseudomonas syringae pv. syringae B728a

Annotation: Radical SAM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 18 to 378 (361 residues), 607 bits, see alignment E=1e-186 PF04055: Radical_SAM" amino acids 29 to 185 (157 residues), 100.9 bits, see alignment E=1.3e-32 PF13353: Fer4_12" amino acids 32 to 124 (93 residues), 28.1 bits, see alignment E=3.4e-10 PF13186: SPASM" amino acids 256 to 321 (66 residues), 34.7 bits, see alignment E=2.7e-12 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 263 to 348 (86 residues), 29.4 bits, see alignment E=8.5e-11

Best Hits

Swiss-Prot: 100% identical to PQQE_PSEU2: PqqA peptide cyclase (pqqE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 100% identity to psb:Psyr_4674)

MetaCyc: 72% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMC1 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Psyr_4674 Radical SAM (Pseudomonas syringae pv. syringae B728a)
MSDIAPVTNTPYIPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDFAKQGQELSTEQWFK
VMQEAREMGAAQIGFSGGEPLVRQDLAELIAEARRLGFYTNLITSGIGLTEEKIIAFKEA
GLDHIQISFQASDEQVNNMLAGSKKAFAQKLEMARAVKRHGYPMVLNFVTHRHNIDRIDK
IIELCLALEADFVELATCQFYGWAHLNRLGLLPTKDQLVRAEAVTNEYRARLEAENHPCK
LIFVTPDYYEERPKACMNGWGNIFLTVTPDGTALPCHGARQMPIQFPNVRDHSMQHIWYD
SFGFNRFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGDAANADPVCSKSYHHGIITQA
RDESETATQTIEELAFRNDRNSRLIAKSS