Protein Info for Psyr_4642 in Pseudomonas syringae pv. syringae B728a

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 TIGR00229: PAS domain S-box protein" amino acids 16 to 137 (122 residues), 48 bits, see alignment E=1.3e-16 amino acids 140 to 262 (123 residues), 58.5 bits, see alignment E=7.4e-20 amino acids 267 to 384 (118 residues), 66.3 bits, see alignment E=2.8e-22 PF13188: PAS_8" amino acids 19 to 70 (52 residues), 23.1 bits, see alignment 1.9e-08 amino acids 142 to 186 (45 residues), 25.2 bits, see alignment 4.2e-09 amino acids 267 to 306 (40 residues), 24.9 bits, see alignment 4.9e-09 PF00989: PAS" amino acids 20 to 127 (108 residues), 24.1 bits, see alignment E=1.1e-08 amino acids 143 to 252 (110 residues), 24 bits, see alignment E=1.2e-08 amino acids 268 to 374 (107 residues), 50.7 bits, see alignment E=6.1e-17 PF08448: PAS_4" amino acids 26 to 131 (106 residues), 27.1 bits, see alignment E=1.5e-09 amino acids 269 to 378 (110 residues), 28.4 bits, see alignment E=5.8e-10 PF13426: PAS_9" amino acids 28 to 129 (102 residues), 36.5 bits, see alignment E=1.7e-12 amino acids 152 to 254 (103 residues), 30.1 bits, see alignment E=1.8e-10 amino acids 274 to 375 (102 residues), 55.2 bits, see alignment E=2.6e-18 PF08447: PAS_3" amino acids 287 to 370 (84 residues), 31 bits, see alignment E=8.5e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 384 to 547 (164 residues), 139.7 bits, see alignment E=7.2e-45 PF00990: GGDEF" amino acids 388 to 545 (158 residues), 169 bits, see alignment E=2.6e-53 PF00563: EAL" amino acids 565 to 800 (236 residues), 260.5 bits, see alignment E=4.5e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4642)

Predicted SEED Role

"sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMF0 at UniProt or InterPro

Protein Sequence (828 amino acids)

>Psyr_4642 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (Pseudomonas syringae pv. syringae B728a)
MRGVINTSDREASCLSEGKFASIFAQCPDAMLIVSLADGHIMDANESFVERTGIPLDEVI
GKTPTELNLWAVPGIGPKVLLQLQTGDIHNLEIPFRRKNGETFSGLMSAQPFEHSPIPAV
LVIVRDITQLKLARQQLQLSEEKFAKAFHASPDGMAITRQQDGMLLEVNEGFCRQTGYSE
KYCLDHSTFDLGIWVDLSERSKLIERMKKHGFVKDMRVRIRNNNGDIRLCELSSQPLIIA
GEDCLLTITRDITESRQMQEKLHLAATVFESTAEGVLITNTDQSISAVNRAFTEITGYSE
SEAIGKTPRLLASGQHDSAFYAAMWHQLAAEGHWQGEISNRRKNGELYPSWLTISAVRNK
DNLLTHFVAVFADISSLKQAQARLDYQAHHDPLTGLPNRILFESRLQAALLHSEESGSLG
AVLFLDLDRFKHINDSLGHPVGDLLLKGIAHRLKETLRDIDTVARLGGDEFIVLLPGLLQ
TSDAQAIANKLLACFSTPFEAGEHELYISPSIGSCVFPTDGTDVATLVKNADAAMYRSKA
KGRNRVESYTCDLSDQASERIALEQELRRALERNQLTLAYQPKIDLLTHTMAGAEALIRW
NHPTFGEVPPEHFIPLAEENGMILQIGDWVLEQACRQMGIWRKTCQPFGPLSVNLAGAQL
RQTNLLERIEQLLTDNGLEPGCLQLEITENFIMSQTQEALAVLHQLKTLGVQLAIDDFGT
GYSSLSYLKRLPLDILKIDQSFVRGLPEDTHDAAIVRAIIALGRSLQLTVIAEGVENSEQ
QQFLTSEGCEQIQGYIISLPLDAEEFRARFLLMNLSDFSDSTAAKPPL