Protein Info for Psyr_4640 in Pseudomonas syringae pv. syringae B728a

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 TIGR01391: DNA primase" amino acids 5 to 419 (415 residues), 489.3 bits, see alignment E=4.6e-151 PF01807: Zn_ribbon_DnaG" amino acids 6 to 101 (96 residues), 140.8 bits, see alignment E=4.2e-45 PF08275: DNAG_N" amino acids 126 to 253 (128 residues), 152.7 bits, see alignment E=2.3e-48 PF13662: Toprim_4" amino acids 261 to 327 (67 residues), 64.7 bits, see alignment E=2.9e-21 PF01751: Toprim" amino acids 262 to 339 (78 residues), 54.7 bits, see alignment E=3.8e-18 PF13362: Toprim_3" amino acids 263 to 358 (96 residues), 32.8 bits, see alignment E=3.1e-11 PF13155: Toprim_2" amino acids 264 to 351 (88 residues), 65.5 bits, see alignment E=1.9e-21 PF10410: DnaB_bind" amino acids 373 to 425 (53 residues), 39.2 bits, see alignment 2.8e-13 PF08278: DnaG_DnaB_bind" amino acids 513 to 636 (124 residues), 89.6 bits, see alignment E=8.3e-29

Best Hits

Swiss-Prot: 81% identical to DNAG_PSEPK: DNA primase (dnaG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to psb:Psyr_4640)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMF2 at UniProt or InterPro

Protein Sequence (651 amino acids)

>Psyr_4640 DNA primase (Pseudomonas syringae pv. syringae B728a)
MAGLIPQSFIDDLLNRTDIVDVVSSRVQLKKAGKNYTACCPFHKEKTPSFSVSPDKQFYY
CFGCGAGGNALGFIMDHDNLDFPQAVEDLAKAAGMEVPREQSVKGQKPRQPTDSPLYPLL
TAAAEFYRQALKSHPSRKAAVDYLKGRGLSGEIARDFGLGFAPPGWDNLYKHLSSDSLQQ
KVMIDAGLLIENAETGKRYDRFRDRVMFPIRDSRGRVIAFGGRVLGDDKPKYLNSPETPV
FHKGQELYGLFEARKFNRNLDEIIVVEGYMDVIALAQQGLRNAVATLGTATSEEHLKRLF
RVVPNVLFCFDGDQAGRNAAWRALEATLSNLQDGRRARFLFLPEGEDPDTLVRSEGTDAF
KARINQHAQPLADYFFEQLTKESDPRSLEGKAHMATLAAPLIDKVPGANLRILMRQRLTE
ITGLTGEAVSHLVQSAPAEAPPSYDPYVDYDAMPDFADYQPQGGYEPQQEWTQKKTGGQN
QKKWDNKSWGKKGKRQDFEPRTPRVPTAVEPPMQAALRTLLHHPELAEKVENASHFAAED
QSNAQLLVALIEARQKNPNLRSLQLIARWHGTEQGRLLRALAEKEWLIEADNLEQQFFDT
ITSLSARQRERSLEHLISKARQTELSAEEKIQLRELLNRNVPAQTPTSTGA