Protein Info for Psyr_4625 in Pseudomonas syringae pv. syringae B728a

Annotation: PpiC-type peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13623: SurA_N_2" amino acids 32 to 111 (80 residues), 36.4 bits, see alignment E=1.7e-12 PF09312: SurA_N" amino acids 32 to 149 (118 residues), 144.6 bits, see alignment E=5.5e-46 PF13624: SurA_N_3" amino acids 33 to 148 (116 residues), 58.3 bits, see alignment E=3.1e-19 PF13145: Rotamase_2" amino acids 162 to 284 (123 residues), 35.7 bits, see alignment E=4.9e-12 amino acids 295 to 393 (99 residues), 33.9 bits, see alignment E=1.8e-11 PF13616: Rotamase_3" amino acids 174 to 280 (107 residues), 56.4 bits, see alignment E=1.4e-18 amino acids 287 to 390 (104 residues), 92.3 bits, see alignment E=1.1e-29 PF00639: Rotamase" amino acids 186 to 277 (92 residues), 64.9 bits, see alignment E=3.8e-21 amino acids 297 to 387 (91 residues), 92.1 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 100% identical to SURA_PSEU2: Chaperone SurA (surA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to psb:Psyr_4625)

MetaCyc: 40% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMG7 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Psyr_4625 PpiC-type peptidyl-prolyl cis-trans isomerase (Pseudomonas syringae pv. syringae B728a)
MNVKTKLSDCLRPLMLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTI
AKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQ
FRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEE
FHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGW
RKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILI
KPSEIRNEEETKRLAQKIYDRIENGEDFAELAKSFSEDPGSALNGGDLNWVDPNSLVPEF
RQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEELQTW
LRQIRDEAYVEIKLPGATQAAQ