Protein Info for Psyr_4621 in Pseudomonas syringae pv. syringae B728a

Annotation: Heat shock protein DnaJ, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details PF05099: TerB" amino acids 60 to 152 (93 residues), 31.2 bits, see alignment E=2.4e-11 PF00226: DnaJ" amino acids 193 to 249 (57 residues), 31.8 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 100% identity to psb:Psyr_4621)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMH1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Psyr_4621 Heat shock protein DnaJ, N-terminal (Pseudomonas syringae pv. syringae B728a)
MLWPGTLIGAGAGYAIASIPGAMLGALLGQALDRRLKLQSWAHLRERLGGRAAIPQNDLL
FVLLGRLAKSGGRVLASHIHQARIEMRRLNLNETDQLRAINAFKRGRDGSDGLRSYLRGL
QGQPDIAEDMLRACWRMAWADGKASRVERELIGVWGMWLGWTGPQIEALAADHDPTKRSP
ISSGDDYKSAMTLLGVRSDTDPLSIKRAYRRLLSRHHPDKIAGSGANPQQVRVATEKTSE
LHNAYRVVKARRGFN