Protein Info for Psyr_4575 in Pseudomonas syringae pv. syringae B728a

Annotation: adenosylmethionine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR03331: S-adenosylmethionine decarboxylase proenzyme" amino acids 4 to 262 (259 residues), 479.4 bits, see alignment E=1.2e-148 PF02675: AdoMet_dc" amino acids 43 to 170 (128 residues), 55 bits, see alignment E=4.6e-19

Best Hits

Swiss-Prot: 100% identical to SPED_PSEU2: S-adenosylmethionine decarboxylase proenzyme (speD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 100% identity to psp:PSPPH_0678)

MetaCyc: 68% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZML7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psyr_4575 adenosylmethionine decarboxylase proenzyme (Pseudomonas syringae pv. syringae B728a)
MKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINSVYDAERLTRILTDVVDII
GANILNIARQDYDPQGASVTILISEQPVTPTESQIEESPGPLPETILAHLDKSHITVHTY
PEIHPVDGIATFRVDIDVSTCGVISPLKALNYLIHKFESDIVTVDYRVRGFTRDVEGKKH
FIDHEINSIQNYLSEDTRNGYQMTDVNVYQENLFHTKMLLKQFELDNYLFGDATSNLSPE
QREQVTAKVKHEMLEIFYGRNVAV