Protein Info for Psyr_4573 in Pseudomonas syringae pv. syringae B728a

Annotation: Histidine triad (HIT) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 3 to 106 (104 residues), 85.4 bits, E=4e-28
• PF01230: HIT
  • amino acids 10 to 106 (97 residues), 102.1 bits, E=2.3e-33

Best Hits

Swiss-Prot: 60% identical to HINT1_BOVIN: Histidine triad nucleotide-binding protein 1 (HINT1) from Bos taurus

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 94% identity to ppw:PputW619_4775)

MetaCyc: 50% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See Q4ZML9 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Psyr_4573 Histidine triad (HIT) protein (Pseudomonas syringae pv. syringae B728a)
MDTLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVIPKKPIRTLNDLTEEDKGLA
GHILFTAQRLALELGCEEGFRVVMNCNELGGQTVYHIHMHVLGQRQMTWPPG