Protein Info for Psyr_4552 in Pseudomonas syringae pv. syringae B728a

Annotation: SSU ribosomal protein S7P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00177: Ribosomal_S7
  • amino acids 1 to 149 (149 residues), 224.6 bits, E=2.1e-71
• TIGR01029: ribosomal protein uS7
  • amino acids 3 to 155 (153 residues), 226.8 bits, E=5.8e-72

Best Hits

Swiss-Prot: 100% identical to RS7_PSEU2: 30S ribosomal protein S7 (rpsG) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 97% identity to pba:PSEBR_c2g105)

MetaCyc: 70% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See Q4ZMP0 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psyr_4552 SSU ribosomal protein S7P (Pseudomonas syringae pv. syringae B728a)
MPRRRVAAKRDVLDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALEKVKERKNSDPLE
IFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRL
AGELMDAAEGKGAAVKKREDVHRMAEANKAFSHYRF