Protein Info for Psyr_4543 in Pseudomonas syringae pv. syringae B728a
Annotation: LSU ribosomal protein L22P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL22_PSEU2: 50S ribosomal protein L22 (rplV) from Pseudomonas syringae pv. syringae (strain B728a)
KEGG orthology group: K02890, large subunit ribosomal protein L22 (inferred from 98% identity to psa:PST_0789)MetaCyc: 69% identical to 50S ribosomal subunit protein L22 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZMP9 at UniProt or InterPro
Protein Sequence (110 amino acids)
>Psyr_4543 LSU ribosomal protein L22P (Pseudomonas syringae pv. syringae B728a) MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEILKKVLESAVANAEH NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK